PeptideDB

Stromatoxin 1

CAS: 741738-59-0 F: C156H237N49O48S7 W: 3791.31

Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selec
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats[1].
Target K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3
Name Stromatoxin 1
CAS 741738-59-0
Sequence Asp-Cys-Thr-Arg-Met-Phe-Gly-Ala-Cys-Arg-Arg-Asp-Ser-Asp-Cys-Cys-Pro-His-Leu-Gly-Cys-Lys-Pro-Thr-Ser-Lys-Tyr-Cys-Ala-Trp-Asp-Gly-Thr-Ile-NH2 (Disulfide bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28)
Shortening DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI-NH2 (Disulfide bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28)
Formula C156H237N49O48S7
Molar Mass 3791.31
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Chen M, et al. Voltage-gated K(+) channels sensitive to stromatoxin-1 regulate myogenic and neurogenic contractions of rat urinary bladder smooth muscle. Am J Physiol Regul Integr Comp Physiol. 2010 Jul;299(1):R177-84.