PeptideDB

BDS-I

CAS: 207621-38-3 F: C210H297N57O56S6 W: 4708.34

BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a sp
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death[1].
Target Kv3.4
Name BDS-I
CAS 207621-38-3
Sequence Ala-Ala-Pro-Cys-Phe-Cys-Ser-Gly-Lys-Pro-Gly-Arg-Gly-Asp-Leu-Trp-Ile-Leu-Arg-Gly-Thr-Cys-Pro-Gly-Gly-Tyr-Gly-Tyr-Thr-Ser-Asn-Cys-Tyr-Lys-Trp-Pro-Asn-Ile-Cys-Cys-Tyr-Pro-His (Disulfide bonds:Cys4-Cys39, Cys6-Cys32, Cys22-Cys40)
Shortening AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH (Disulfide bonds:Cys4-Cys39, Cys6-Cys32, Cys22-Cys40)
Formula C210H297N57O56S6
Molar Mass 4708.34
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Ciccone R, et al. Synthesis and Pharmacological Evaluation of a Novel Peptide Based on聽Anemonia sulcata聽BDS-I Toxin as a New KV3.4 Inhibitor Exerting a Neuroprotective Effect Against Amyloid-尾 Peptide. Front Chem. 2019 Jul 9;7:479.