| Bioactivity | BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death[1]. |
| Target | Kv3.4 |
| Name | BDS-I |
| CAS | 207621-38-3 |
| Sequence | Ala-Ala-Pro-Cys-Phe-Cys-Ser-Gly-Lys-Pro-Gly-Arg-Gly-Asp-Leu-Trp-Ile-Leu-Arg-Gly-Thr-Cys-Pro-Gly-Gly-Tyr-Gly-Tyr-Thr-Ser-Asn-Cys-Tyr-Lys-Trp-Pro-Asn-Ile-Cys-Cys-Tyr-Pro-His (Disulfide bonds：Cys4-Cys39, Cys6-Cys32, Cys22-Cys40) |
| Shortening | AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH (Disulfide bonds：Cys4-Cys39, Cys6-Cys32, Cys22-Cys40) |
| Formula | C210H297N57O56S6 |
| Molar Mass | 4708.34 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Ciccone R, et al. Synthesis and Pharmacological Evaluation of a Novel Peptide Based on聽Anemonia sulcata聽BDS-I Toxin as a New KV3.4 Inhibitor Exerting a Neuroprotective Effect Against Amyloid-尾 Peptide. Front Chem. 2019 Jul 9;7:479. |
BDS-I
CAS: 207621-38-3 F: C210H297N57O56S6 W: 4708.34
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a sp
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.