| Bioactivity | Pterinotoxin-1 is a sodium channel inhibitor peptide toxin[1]. |
| Name | Pterinotoxin-1 |
| Sequence | Asp-Asp-Cys-Leu-Gly-Met-Phe-Ser-Ser-Cys-Asp-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Glu-Gly-Arg-Lys-Cys-Asn-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Val-Leu-NH2 (Disulfide bridge: Cys3-Cys18,Cys10-Cys23,Cys17-Cys30) |
| Shortening | DDCLGMFSSCDPDNDKCCEGRKCNRKDKWCKYVL-NH2 (Disulfide bridge: Cys3-Cys18,Cys10-Cys23,Cys17-Cys30) |
| Formula | C163H251N49O53S7 |
| Molar Mass | 3969.49 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Zhang Y Y, et al. Structural and functional diversity of peptide toxins from tarantula Haplopelma hainanum (Ornithoctonus hainana) venom revealed by transcriptomic, peptidomic, and patch clamp approaches[J]. Journal of Biological Chemistry, 2015, 290(22): 14192-14207. |