PeptideDB

Pterinotoxin-1

CAS: F: C163H251N49O53S7 W: 3969.49

Pterinotoxin-1 is a sodium channel inhibitor peptide toxin.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Pterinotoxin-1 is a sodium channel inhibitor peptide toxin[1].
Name Pterinotoxin-1
Sequence Asp-Asp-Cys-Leu-Gly-Met-Phe-Ser-Ser-Cys-Asp-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Glu-Gly-Arg-Lys-Cys-Asn-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Val-Leu-NH2 (Disulfide bridge: Cys3-Cys18,Cys10-Cys23,Cys17-Cys30)
Shortening DDCLGMFSSCDPDNDKCCEGRKCNRKDKWCKYVL-NH2 (Disulfide bridge: Cys3-Cys18,Cys10-Cys23,Cys17-Cys30)
Formula C163H251N49O53S7
Molar Mass 3969.49
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Zhang Y Y, et al. Structural and functional diversity of peptide toxins from tarantula Haplopelma hainanum (Ornithoctonus hainana) venom revealed by transcriptomic, peptidomic, and patch clamp approaches[J]. Journal of Biological Chemistry, 2015, 290(22): 14192-14207.