| Bioactivity | Prolactin-Releasing Peptide (1-31) (rat) is a UHR-1/GRP10 receptor ligand. Prolactin-Releasing Peptide (1-31) (rat) reduces fasting-induced food intake, increases plasma levels of LH, FSH, and testosterone in rats[1][2]. |
| Name | Prolactin-Releasing Peptide (1-31) (rat) |
| CAS | 215510-06-8 |
| Sequence | Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
| Shortening | SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 |
| Formula | C156H242N54O43S |
| Molar Mass | 3593.99 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Ellacott KL, et al. Characterization of a naturally-occurring polymorphism in the UHR-1 gene encoding the putative rat prolactin-releasing peptide receptor. Peptides. 2005 Apr;26(4):675-81. [2]. https://pubmed.ncbi.nlm.nih.gov/10803604/ |
Prolactin-Releasing Peptide (1-31) (rat)
CAS: 215510-06-8 F: C156H242N54O43S W: 3593.99
Prolactin-Releasing Peptide (1-31) (rat) is a UHR-1/GRP10 receptor ligand. Prolactin-Releasing Peptide (1-31) (rat) redu
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.