PeptideDB

Prokineticin 2 Isoform 2 (human)

CAS: 423206-00-2 F: C379H616N114O101S13 W: 8802.49

Prokineticin 2 Isoform 2 (human) is a hypothalamic neuropeptide. Prokineticin 2 Isoform 2 (human) decreases food intake
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Prokineticin 2 Isoform 2 (human) is a hypothalamic neuropeptide. Prokineticin 2 Isoform 2 (human) decreases food intake and involves in thermoregulation and energy metabolism in rodents. Prokineticin 2 has the potential for the research of hyperglycemia, metabolic syndrome (MetS) and obesity[1].
Name Prokineticin 2 Isoform 2 (human)
CAS 423206-00-2
Sequence Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys
Shortening AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPF
Formula C379H616N114O101S13
Molar Mass 8802.49
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Mortreux M, et al. New roles for prokineticin 2 in feeding behavior, insulin resistance and type 2 diabetes: Studies in mice and humans. Mol Metab. 2019 Nov;29:182-196.