PeptideDB

Palopegteriparatide

CAS: 2222514-07-8 F: W:

Palopegteriparatide (Transcon PTH) is a long-acting parathyroid hormone (PTH) prodrug that can maintain normal and stabl
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Palopegteriparatide (Transcon PTH) is a long-acting parathyroid hormone (PTH) prodrug that can maintain normal and stable calcium concentrations without the need for calcium and active vitamin D replacement. Palopegteriparatide can be used in the research of hypoparathyroidism[1][2].
CAS 2222514-07-8
Sequence {X}-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe (X= O-methylpolyethylene glycol (2 x 20 kDa mPEG)-Aib)
Shortening {X}-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (X= O-methylpolyethylene glycol (2 x 20 kDa mPEG)-Aib)
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Khan AA, et al. Efficacy and Safety of Parathyroid Hormone Replacement With TransCon PTH in Hypoparathyroidism: 26-Week Results From the Phase 3 PaTHway Trial. J Bone Miner Res. 2023;38(1):14-25. [2]. Kontogeorgos G. Parathyroid Hormone Hyper-and Hypoparathyroidism Effect of Treatment and Long-term Follow-up Studies[M]. 2024.