PeptideDB

MmTx2 toxin

CAS: F: C295H450N94O97S10 W: 7185.95

MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtai
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain[1].
Name MmTx2 toxin
Sequence Leu-Thr-Cys-Lys-Thr-Cys-Pro-Phe-Thr-Thr-Cys-Pro-Asn-Ser-Glu-Ser-Cys-Pro-Gly-Gly-Gln-Ser-Ile-Cys-Tyr-Gln-Arg-Lys-Trp-Glu-Glu-His-His-Gly-Glu-Arg-Ile-Glu-Arg-Arg-Cys-Val-Ala-Asn-Cys-Pro-Ala-Phe-Gly-Ser-His-Asp-Thr-Ser-Leu-Leu-Cys-Cys-Thr-Arg-Asp-Asn-Cys-Asn (Disulfide bridge: Cys3-Cys24,Cys6-Cys11,Cys17-Cys41,Cys45-Cys57,Cys58-Cys63)
Shortening LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCCTRDNCN (Disulfide bridge: Cys3-Cys24,Cys6-Cys11,Cys17-Cys41,Cys45-Cys57,Cys58-Cys63)
Formula C295H450N94O97S10
Molar Mass 7185.95
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Rosso JP, et al. MmTX1 and MmTX2 from coral snake venom potently modulate GABAA receptor activity. Proc Natl Acad Sci U S A. 2015 Feb 24;112(8):E891-900.