| Bioactivity | MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain[1]. |
| Name | MmTx2 toxin |
| Sequence | Leu-Thr-Cys-Lys-Thr-Cys-Pro-Phe-Thr-Thr-Cys-Pro-Asn-Ser-Glu-Ser-Cys-Pro-Gly-Gly-Gln-Ser-Ile-Cys-Tyr-Gln-Arg-Lys-Trp-Glu-Glu-His-His-Gly-Glu-Arg-Ile-Glu-Arg-Arg-Cys-Val-Ala-Asn-Cys-Pro-Ala-Phe-Gly-Ser-His-Asp-Thr-Ser-Leu-Leu-Cys-Cys-Thr-Arg-Asp-Asn-Cys-Asn (Disulfide bridge: Cys3-Cys24,Cys6-Cys11,Cys17-Cys41,Cys45-Cys57,Cys58-Cys63) |
| Shortening | LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCCTRDNCN (Disulfide bridge: Cys3-Cys24,Cys6-Cys11,Cys17-Cys41,Cys45-Cys57,Cys58-Cys63) |
| Formula | C295H450N94O97S10 |
| Molar Mass | 7185.95 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Rosso JP, et al. MmTX1 and MmTX2 from coral snake venom potently modulate GABAA receptor activity. Proc Natl Acad Sci U S A. 2015 Feb 24;112(8):E891-900. |