| Bioactivity | MLH40 is a peptide inhibitor with activity against Dengue virus (DENV) infection, which is found in the conserved ectodomain region of DENV membrane protein. MLH40 inhibits DENV through its N-terminal loop interaction with DENV envelope protein and altering the dimer conformation[1]. |
| Sequence | Ser-Val-Ala-Leu-Val-Pro-His-Val-Gly-Met-Gly-Leu-Glu-Thr-Arg-Thr-Glu-Thr-Trp-Met-Ser-Ser-Glu-Gly-Ala-Trp-Lys-His-Val-Gln-Arg-Ile-Glu-Thr-Trp-Ile-Leu-Arg-His-Pro-Gly |
| Shortening | SVALVPHVGMGLETRTETWMSSEGAWKHVQRIETWILRHPG |
| Formula | C209H325N61O58S2 |
| Molar Mass | 4684.32 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Panya A, et al. A peptide inhibitor derived from the conserved ectodomain region of DENV membrane (M) protein with activity against dengue virus infection. Chem Biol Drug Des. 2015 Nov;86(5):1093-104. |