PeptideDB

MLH40

CAS: F: C209H325N61O58S2 W: 4684.32

MLH40 is a peptide inhibitor with activity against Dengue virus (DENV) infection, which is found in the conserved ectodo
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity MLH40 is a peptide inhibitor with activity against Dengue virus (DENV) infection, which is found in the conserved ectodomain region of DENV membrane protein. MLH40 inhibits DENV through its N-terminal loop interaction with DENV envelope protein and altering the dimer conformation[1].
Sequence Ser-Val-Ala-Leu-Val-Pro-His-Val-Gly-Met-Gly-Leu-Glu-Thr-Arg-Thr-Glu-Thr-Trp-Met-Ser-Ser-Glu-Gly-Ala-Trp-Lys-His-Val-Gln-Arg-Ile-Glu-Thr-Trp-Ile-Leu-Arg-His-Pro-Gly
Shortening SVALVPHVGMGLETRTETWMSSEGAWKHVQRIETWILRHPG
Formula C209H325N61O58S2
Molar Mass 4684.32
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Panya A, et al. A peptide inhibitor derived from the conserved ectodomain region of DENV membrane (M) protein with activity against dengue virus infection. Chem Biol Drug Des. 2015 Nov;86(5):1093-104.