| Bioactivity | Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na+ channel[1]. |
| Target | Kd: 15 nM (Cav3.1 (α1G T-type) Ca2+ channel) |
| Name | Kurtoxin |
| Sequence | Lys-Ile-Asp-Gly-Tyr-Pro-Val-Asp-Tyr-Trp-Asn-Cys-Lys-Arg-Ile-Cys-Trp-Tyr-Asn-Asn-Lys-Tyr-Cys-Asn-Asp-Leu-Cys-Lys-Gly-Leu-Lys-Ala-Asp-Ser-Gly-Tyr-Cys-Trp-Gly-Trp-Thr-Leu-Ser-Cys-Tyr-Cys-Gln-Gly-Leu-Pro-Asp-Asn-Ala-Arg-Ile-Lys-Arg-Ser-Gly-Arg-Cys-Arg-Ala (Disulfide bridge: Cys12-Cys61,Cys16-Cys37,Cys23-Cys44,Cys27-Cys46) |
| Shortening | KIDGYPVDYWNCKRICWYNNKYCNDLCKGLKADSGYCWGWTLSCYCQGLPDNARIKRSGRCRA (Disulfide bridge: Cys12-Cys61,Cys16-Cys37,Cys23-Cys44,Cys27-Cys46) |
| Formula | C324H478N94O90S8 |
| Molar Mass | 7386.36 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Lee CW, et al. Solution structure of kurtoxin: a gating modifier selective for Cav3 voltage-gated Ca(2+) channels. Biochemistry. 2012 Mar 6;51(9):1862-73. |