| Bioactivity | FS-2 is a potent and specific L-type CaV channel inhibitor. FS-2 inhibits high K+ or glucose induced L-type Ca2+ influx in RIN beta cells[1]. |
| Name | FS-2 |
| Sequence | Arg-Ile-Cys-Tyr-Ser-His-Lys-Ala-Ser-Leu-Pro-Arg-Ala-Thr-Lys-Thr-Cys-Val-Glu-Asn-Thr-Cys-Tyr-Lys-Met-Phe-Ile-Arg-Thr-His-Arg-Gln-Tyr-Ile-Ser-Glu-Arg-Gly-Cys-Gly-Cys-Pro-Thr-Ala-Met-Trp-Pro-Tyr-Gln-Thr-Glu-Cys-Cys-Lys-Gly-Asp-Arg-Cys-Asn-Lys (Disulfide bridge:Cys3-Cys22;Cys17-Cys39;Cys41-Cys52;Cys53-Cys58) |
| Shortening | RICYSHKASLPRATKTCVENTCYKMFIRTHRQYISERGCGCPTAMWPYQTECCKGDRCNK (Disulfide bridge:Cys3-Cys22;Cys17-Cys39;Cys41-Cys52;Cys53-Cys58) |
| Formula | C297H462N92O86S10 |
| Molar Mass | 7018.06 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Schweitz H, et al. Purification and pharmacological characterization of peptide toxins from the black mamba (Dendroaspis polylepis) venom. Toxicon. 1990;28(7):847-56. |