PeptideDB

Jingzhaotoxin XI

CAS: F: C158H234N44O47S7 W: 3726.27

Jingzhaotoxin XI (JZTX-XI) is a sodium conductance inhibitor with an IC50 of 124 nM. Jingzhaotoxin XI slows the fast ina
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Jingzhaotoxin XI (JZTX-XI) is a sodium conductance inhibitor with an IC50 of 124 nM. Jingzhaotoxin XI slows the fast inactivation (EC50=1.18±0.2 μM) of Nav1.5 expressed in Chinese hamster ovary (CHO-K1) cells[1].
Target IC50: 124 nM (sodium conductance)
Name Jingzhaotoxin XI
Sequence Glu-Cys-Arg-Lys-Met-Phe-Gly-Gly-Cys-Ser-Val-Asp-Ser-Asp-Cys-Cys-Ala-His-Leu-Gly-Cys-Lys-Pro-Thr-Leu-Lys-Tyr-Cys-Ala-Trp-Asp-Gly-Thr-Phe-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys28)
Shortening ECRKMFGGCSVDSDCCAHLGCKPTLKYCAWDGTF-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys28)
Formula C158H234N44O47S7
Molar Mass 3726.27
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Tang C, et al. The tarantula toxin jingzhaotoxin-XI (κ-theraphotoxin-Cj1a) regulates the activation and inactivation of the voltage-gated sodium channel Nav1.5. Toxicon. 2014 Dec 15;92:6-13.