| Bioactivity | Helodormin is a VIP-secretin-like peptide isolated from the venom of the Mexican monster lizard (Heloderma suspectum). Helodormin affects a variety of cellular functions by modulating intracellular signaling through activation of adenylate cyclase. Helodormin can be used to study the evolution and function of the secretin and VIP peptide families[1]. |
| CAS | 89468-62-2 |
| Sequence | His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2 |
| Shortening | HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2 |
| Formula | C176H285N47O49 |
| Molar Mass | 3843.50 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Hoshino M, et al. Primary structure of helodermin, a VIP-secretin-like peptide isolated from Gila monster venom[J]. FEBS letters, 1984, 178(2): 233-239. |
Helodormin
CAS: 89468-62-2 F: C176H285N47O49 W: 3843.50
Helodormin is a VIP-secretin-like peptide isolated from the venom of the Mexican monster lizard (Heloderma suspectum). H
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.