| Bioactivity | GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist, extracted from patent US 20160369010 A1. | ||||||
| Name | GLP-1 moiety from Dulaglutide | ||||||
| Shortening | HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG | ||||||
| Formula | C149H221N37O49 | ||||||
| Molar Mass | 3314.62 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
GLP-1 moiety from Dulaglutide
CAS: F: C149H221N37O49 W: 3314.62
GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GL
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.