| Bioactivity | Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM). | ||||||
| Name | Lixisenatide acetate | ||||||
| CAS | 1997361-87-1 | ||||||
| Shortening | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | ||||||
| Formula | C215H347N61O65S.6C2H4O2 | ||||||
| Molar Mass | 5218.79 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Lixisenatide acetate
CAS: 1997361-87-1 F: C215H347N61O65S.6C2H4O2 W: 5218.79
Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 d
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.