Bioactivity | Eneboparatide (AZP-3601) acetate, a 36 amino-acid PTH analog, is also a parathyroid hormone receptor 1 (PTHR1) agonist. Eneboparatide acetate increases albumin-adjusted serum calcium values, but stayed within normal laboratory range[1]. |
Name | Eneboparatide acetate |
Sequence | Ala-Val-Ala-Glu-Ile-Gln-Leu-Met-His-Gln-Arg-Ala-Lys-Trp-Ile-Gln-Asp-Ala-Arg-Arg-Arg-Ala-Phe-Leu-His-Lys-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile |
Shortening | AVAEIQLMHQRAKWIQDARRRAFLHKLIAEIHTAEI |
Formula | C191H312N60O49S |
Molar Mass | 4325.00 |
Transport | Room temperature in continental US; may vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Reference | [1]. Allas S, et al. A Single Administration of AZP-3601, a Novel, Long-Acting PTH Analog, Induces a Significant and Sustained Calcemic Response: Preliminary Data From a Randomized, Double-Blind, Placebo-Controlled Phase 1 Study. J Endocr Soc. 2021 May 3;5(Suppl 1):A254. |