| Bioactivity | D-JNKI-1 (AM-111) is a highly potent and cell-permeable peptide inhibitor of JNK. | ||||||
| Invitro | D-JNKI-1 (AM-111; 1 μM-1 mM) treatment prevents apoptosis and loss of neomycin-exposed hair cells[1]. | ||||||
| Name | D-JNKI-1 | ||||||
| CAS | 1445179-97-4 | ||||||
| Shortening | DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2 | ||||||
| Formula | C164H286N66O40 | ||||||
| Molar Mass | 3822.44 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |