| Bioactivity | GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. | ||||||
| Name | GLP-1(7-37) | ||||||
| CAS | 106612-94-6 | ||||||
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly | ||||||
| Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG | ||||||
| Formula | C151H228N40O47 | ||||||
| Molar Mass | 3355.67 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |