| Bioactivity | Citrullinated amyloid-β (1-42) peptide (human) (Citrullinated Aβ (1-42)) is a modified form of β-Amyloid (1-42) (HY-P1363) with a citrullination at the Arg5 site. Compared to the unmodified β-Amyloid (1-42), its formation of soluble low-molecular-weight oligomers is enhanced, the rate of fibril formation is reduced, and like unmodified Aβ42, it forms protofibrils comprised of parallel β-sheets[1]. |
| Name | Citrullinated amyloid-β (1-42) peptide (human) |
| Sequence | Asp-Ala-Glu-Phe-{Cit}-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
| Shortening | DAEF-{Cit}-HDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Formula | C203H310N54O61S |
| Molar Mass | 4515.02 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Osaki D, Hiramatsu H. Citrullination and deamidation affect aggregation properties of amyloid β-proteins. Amyloid. 2016 Dec;23(4):234-241. |
Citrullinated amyloid-β (1-42) peptide (human)
CAS: F: C203H310N54O61S W: 4515.02
Citrullinated amyloid-β (1-42) peptide (human) (Citrullinated Aβ (1-42)) is a modified form of β-Amyloid (1-42) (HY-P
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.