PeptideDB

ChTX-Lq2

CAS: F: C177H280N60O55S7 W: 4352.94

ChTX-Lq2 is a Ca2+-activated K+ efflux inhibitor with a Kd of 43 nM.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity ChTX-Lq2 is a Ca2+-activated K+ efflux inhibitor with a Kd of 43 nM[1].
Target Kd: 43 nM (Ca2+-activated K+ efflux)
Name ChTX-Lq2
Sequence Gln-Phe-Thr-Gln-Glu-Ser-Cys-Thr-Ala-Ser-Asn-Gln-Cys-Trp-Ser-Ile-Cys-Lys-Arg-Leu-His-Asn-Thr-Asn-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridge: Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)
Shortening QFTQESCTASNQCWSICKRLHNTNRGKCMNKKCRCYS (Disulfide bridge: Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)
Formula C177H280N60O55S7
Molar Mass 4352.94
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Lucchesi K, et al. Analysis of the blocking activity of charybdotoxin homologs and iodinated derivatives against Ca2+-activated K+ channels. J Membr Biol. 1989 Aug;109(3):269-81.