| Bioactivity | ChTX-Lq2 is a Ca2+-activated K+ efflux inhibitor with a Kd of 43 nM[1]. |
| Target | Kd: 43 nM (Ca2+-activated K+ efflux) |
| Name | ChTX-Lq2 |
| Sequence | Gln-Phe-Thr-Gln-Glu-Ser-Cys-Thr-Ala-Ser-Asn-Gln-Cys-Trp-Ser-Ile-Cys-Lys-Arg-Leu-His-Asn-Thr-Asn-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridge: Cys7-Cys28,Cys13-Cys33,Cys17-Cys35) |
| Shortening | QFTQESCTASNQCWSICKRLHNTNRGKCMNKKCRCYS (Disulfide bridge: Cys7-Cys28,Cys13-Cys33,Cys17-Cys35) |
| Formula | C177H280N60O55S7 |
| Molar Mass | 4352.94 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Lucchesi K, et al. Analysis of the blocking activity of charybdotoxin homologs and iodinated derivatives against Ca2+-activated K+ channels. J Membr Biol. 1989 Aug;109(3):269-81. |