| Bioactivity | AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K+ current (Ki: 131 nM)[1][2]. |
| Target | Kv4 channel |
| Name | AmmTX3 |
| Sequence | {Glp}-Ile-Glu-Thr-Asn-Lys-Lys-Cys-Gln-Gly-Gly-Ser-Cys-Ala-Ser-Val-Cys-Arg-Lys-Val-Ile-Gly-Val-Ala-Ala-Gly-Lys-Cys-Ile-Asn-Gly-Arg-Cys-Val-Cys-Tyr-Pro (Disulfide bonds：Cys8-Cys28, Cys13-Cys33 and Cys17-Cys35) |
| Shortening | {Glp}-IETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP (Disulfide bonds：Cys8-Cys28, Cys13-Cys33 and Cys17-Cys35) |
| Formula | C158H262N50O48S6 |
| Molar Mass | 3822.47 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Vacher H, et al. Expanding the scorpion toxin alpha-KTX 15 family with AmmTX3 from Androctonus mauretanicus. Eur J Biochem. 2002 Dec;269(24):6037-41. https:// [2]. Maffie JK, et al. Dipeptidyl-peptidase-like-proteins confer high sensitivity to the scorpion toxin AmmTX3 to Kv4-mediated A-type K+ channels. J Physiol. 2013 May 15;591(10):2419-27. |