| Bioactivity | Adrenocorticotropic Hormone (ACTH) (1-39), human acetate is a full length human adrenocorticotropic hormone[1]. |
| Name | Adrenocorticotropic Hormone (ACTH) (1-39), human acetate |
| Sequence | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
| Shortening | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Formula | C207H308N56O58S.xC2H4O2 |
| Molar Mass | 4541.14 (free base) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. TOSHIAKI NAGANO, et al. Enzyme Immunoassay of Adrenocorticotropic Hormone-like Immunoreactive Substance in Human Plasma. Japanese Journal of Hospital Pharmacy, 1999, 25(3): 257-263. |