| Bioactivity | Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research[1]. |
| Target | IC50: 1.1 nM (Kv1.3), ＞750 nM (Kv1.1). |
| Name | Aam-KTX |
| Sequence | Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Thr-Gly-Ser-His-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Ile-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys-NH2 (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35) |
| Shortening | GVEINVKCTGSHQCIKPCKDAGMRFGKCINRKCHCTPK-NH2 (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35) |
| Formula | C174H288N58O48S7 |
| Molar Mass | 4184.96 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Zhu S, et al. Molecular diversity and functional evolution of scorpion potassium channel toxins. Mol Cell Proteomics. 2011 Feb;10(2):M110.002832. |