PeptideDB

Aam-KTX

CAS: F: C174H288N58O48S7 W: 4184.96

Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research[1].
Target IC50: 1.1 nM (Kv1.3), >750 nM (Kv1.1).
Name Aam-KTX
Sequence Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Thr-Gly-Ser-His-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Ile-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys-NH2 (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
Shortening GVEINVKCTGSHQCIKPCKDAGMRFGKCINRKCHCTPK-NH2 (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
Formula C174H288N58O48S7
Molar Mass 4184.96
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Zhu S, et al. Molecular diversity and functional evolution of scorpion potassium channel toxins. Mol Cell Proteomics. 2011 Feb;10(2):M110.002832.