| Bioactivity | Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D,α2A,α2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity[1]. |
| Target | pIC50: 8.79 (M4 mAChR), 6.71 (M1 mAChR), 8.86 (α1A-adrenoceptor), 8.49 (α2A-adrenoceptor), 8.13 (α1D-adrenoceptor), 7.57 (α1B-adrenoceptor), 7.29 (α2C-adrenoceptor), <6.5 (α2B-adrenoceptor) |
| Name | Muscarinic toxin 3 |
| CAS | 873336-87-9 |
| Sequence | Leu-Thr-Cys-Val-Thr-Lys-Asn-Thr-Ile-Phe-Gly-Ile-Thr-Thr-Glu-Asn-Cys-Pro-Ala-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Arg-Trp-His-Tyr-Val-Ile-Pro-Arg-Tyr-Thr-Glu-Ile-Thr-Arg-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ile-Pro-Glu-Asn-Tyr-Asp-Ser-Ile-His-Cys-Cys-Lys-Thr-Asp-Lys-Cys-Asn-Glu (Disulfide bridge: Cys3-Cys24,Cys17-Cys42,Cys46-Cys57,Cys58-Cys63) |
| Shortening | LTCVTKNTIFGITTENCPAGQNLCFKRWHYVIPRYTEITRGCAATCPIPENYDSIHCCKTDKCNE (Disulfide bridge: Cys3-Cys24,Cys17-Cys42,Cys46-Cys57,Cys58-Cys63) |
| Formula | C319H489N89O97S8 |
| Molar Mass | 7379.35 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Näreoja K, et al. Adrenoceptor activity of muscarinic toxins identified from mamba venoms. Br J Pharmacol. 2011 Sep;164(2b):538-50. |
Muscarinic toxin 3
CAS: 873336-87-9 F: C319H489N89O97S8 W: 7379.35
Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.