PeptideDB

(Pro3) GIP, human

CAS: 299898-52-5 F: C226H338N60O64S W: 4951.53

(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity (Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes[1][2].
Target EC50: 0.026 nM (hGIPR) Ki/Kd: 0.90 nM (hGIPR); 1.1 nM (Rat GIPR); 0.72 nM (Mouse GIPR)
Invitro (Pro3) GIP, human induces cAMP accumulation with an EC50 value of 0.026 nM[2].(Pro3) GIP, human has high binding affinity for human GIPR, Rat GIPR and Mouse GIPR with Ki/ Kd values of 0.90 nM, 1.1 nM and 0.72 nM, respectively[2].
In Vivo (Pro3) GIP, human has comparatively weak partial agonist effect in rodent models[2].
Name (Pro3) GIP, human
CAS 299898-52-5
Shortening YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Formula C226H338N60O64S
Molar Mass 4951.53
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Victor A Gault, et al. Chemical ablation of gastric inhibitory polypeptide receptor action by daily (Pro3)GIP administration improves glucose tolerance and ameliorates insulin resistance and abnormalities of islet structure in obesity-related diabetes. Diabetes. 2005 Aug;54(8):2436-46. [2]. A H Sparre-Ulrich, et al. Species-specific action of (Pro3)GIP - a full agonist at human GIP receptors, but a partial agonist and competitive antagonist at rat and mouse GIP receptors. Br J Pharmacol. 2016 Jan;173(1):27-38.