| Bioactivity | (Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes[1][2]. |
| Target | EC50: 0.026 nM (hGIPR) Ki/Kd: 0.90 nM (hGIPR); 1.1 nM (Rat GIPR); 0.72 nM (Mouse GIPR) |
| Invitro | (Pro3) GIP, human induces cAMP accumulation with an EC50 value of 0.026 nM[2].(Pro3) GIP, human has high binding affinity for human GIPR, Rat GIPR and Mouse GIPR with Ki/ Kd values of 0.90 nM, 1.1 nM and 0.72 nM, respectively[2]. |
| In Vivo | (Pro3) GIP, human has comparatively weak partial agonist effect in rodent models[2]. |
| Name | (Pro3) GIP, human |
| CAS | 299898-52-5 |
| Shortening | YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Formula | C226H338N60O64S |
| Molar Mass | 4951.53 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Victor A Gault, et al. Chemical ablation of gastric inhibitory polypeptide receptor action by daily (Pro3)GIP administration improves glucose tolerance and ameliorates insulin resistance and abnormalities of islet structure in obesity-related diabetes. Diabetes. 2005 Aug;54(8):2436-46. [2]. A H Sparre-Ulrich, et al. Species-specific action of (Pro3)GIP - a full agonist at human GIP receptors, but a partial agonist and competitive antagonist at rat and mouse GIP receptors. Br J Pharmacol. 2016 Jan;173(1):27-38. |
(Pro3) GIP, human
CAS: 299898-52-5 F: C226H338N60O64S W: 4951.53
(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.