PeptideDB

ω-Tbo-IT1

CAS: F: C171H285N61O53S9 W: 4332.05

ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of ins
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel[1].
Name ω-Tbo-IT1
Sequence Cys-Ala-Ser-Lys-Asn-Glu-Arg-Cys-Gly-Asn-Ala-Leu-Tyr-Gly-Thr-Lys-Gly-Pro-Gly-Cys-Cys-Asn-Gly-Lys-Cys-Ile-Cys-Arg-Thr-Val-Pro-Arg-Lys-Gly-Val-Asn-Ser-Cys-Arg-Cys-Met (Disulfide bridge: Cys1-Cys21; Cys8-Cys25; Cys20-Cys40; Cys27-Cys38)
Shortening CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM (Disulfide bridge: Cys1-Cys21; Cys8-Cys25; Cys20-Cys40; Cys27-Cys38)
Formula C171H285N61O53S9
Molar Mass 4332.05
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Mikov AN, et al. ω-Tbo-IT1-New Inhibitor of Insect Calcium Channels Isolated from Spider Venom. Sci Rep. 2015 Nov 27;5:17232.