| Bioactivity | ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel[1]. |
| Name | ω-Tbo-IT1 |
| Sequence | Cys-Ala-Ser-Lys-Asn-Glu-Arg-Cys-Gly-Asn-Ala-Leu-Tyr-Gly-Thr-Lys-Gly-Pro-Gly-Cys-Cys-Asn-Gly-Lys-Cys-Ile-Cys-Arg-Thr-Val-Pro-Arg-Lys-Gly-Val-Asn-Ser-Cys-Arg-Cys-Met (Disulfide bridge: Cys1-Cys21; Cys8-Cys25; Cys20-Cys40; Cys27-Cys38) |
| Shortening | CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM (Disulfide bridge: Cys1-Cys21; Cys8-Cys25; Cys20-Cys40; Cys27-Cys38) |
| Formula | C171H285N61O53S9 |
| Molar Mass | 4332.05 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Mikov AN, et al. ω-Tbo-IT1-New Inhibitor of Insect Calcium Channels Isolated from Spider Venom. Sci Rep. 2015 Nov 27;5:17232. |