| Bioactivity | ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a blocks voltage-gated calcium channels[1][2]. |
| Name | ω-Hexatoxin-Hv1a |
| CAS | 193981-10-1 |
| Sequence | Ser-Pro-Thr-Cys-Ile-Pro-Ser-Gly-Gln-Pro-Cys-Pro-Tyr-Asn-Glu-Asn-Cys-Cys-Ser-Gln-Ser-Cys-Thr-Phe-Lys-Glu-Asn-Glu-Asn-Gly-Asn-Thr-Val-Lys-Arg-Cys-Asp (Disulfide bridge：Cys4-Cys18; Cys11-Cys22; Cys17-Cys36) |
| Shortening | SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD (Disulfide bridge：Cys4-Cys18; Cys11-Cys22; Cys17-Cys36) |
| Formula | C162H247N49O61S6 |
| Molar Mass | 4049.38 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Powell ME, et al. Demonstrating the potential of a novel spider venom-based biopesticide for target-specific control of the small hive beetle, a serious pest of the European honeybee. J Pest Sci (2004). 2020;93(1):391-402. [2]. Yang S, et al. Effect of insecticidal fusion proteins containing spider toxins targeting sodium and calcium ion channels on pyrethroid-resistant strains of peach-potato aphid (Myzus persicae). Pest Manag Sci. 2015 Jul;71(7):951-6. |
ω-Hexatoxin-Hv1a
CAS: 193981-10-1 F: C162H247N49O61S6 W: 4049.38
ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a bloc
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.