PeptideDB

Dc1a

CAS: F: C276H414N76O84S8 W: 6397.22

Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the de
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities[1].
Name Dc1a
Sequence Ala-Lys-Asp-Gly-Asp-Val-Glu-Gly-Pro-Ala-Gly-Cys-Lys-Lys-Tyr-Asp-Val-Glu-Cys-Asp-Ser-Gly-Glu-Cys-Cys-Gln-Lys-Gln-Tyr-Leu-Trp-Tyr-Lys-Trp-Arg-Pro-Leu-Asp-Cys-Arg-Cys-Leu-Lys-Ser-Gly-Phe-Phe-Ser-Ser-Lys-Cys-Val-Cys-Arg-Asp-Val (Disulfide bonds:Cys12-Cys25, Cys19-Cys39, Cys24-Cys53, Cys41-Cys51)
Shortening AKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV (Disulfide bonds:Cys12-Cys25, Cys19-Cys39, Cys24-Cys53, Cys41-Cys51)
Formula C276H414N76O84S8
Molar Mass 6397.22
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Bende NS, et al. A distinct sodium channel voltage-sensor locus determines insect selectivity of the spider toxin Dc1a. Nat Commun. 2014 Jul 11;5:4350.