| Bioactivity | Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities[1]. |
| Name | Dc1a |
| Sequence | Ala-Lys-Asp-Gly-Asp-Val-Glu-Gly-Pro-Ala-Gly-Cys-Lys-Lys-Tyr-Asp-Val-Glu-Cys-Asp-Ser-Gly-Glu-Cys-Cys-Gln-Lys-Gln-Tyr-Leu-Trp-Tyr-Lys-Trp-Arg-Pro-Leu-Asp-Cys-Arg-Cys-Leu-Lys-Ser-Gly-Phe-Phe-Ser-Ser-Lys-Cys-Val-Cys-Arg-Asp-Val (Disulfide bonds:Cys12-Cys25, Cys19-Cys39, Cys24-Cys53, Cys41-Cys51) |
| Shortening | AKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV (Disulfide bonds:Cys12-Cys25, Cys19-Cys39, Cys24-Cys53, Cys41-Cys51) |
| Formula | C276H414N76O84S8 |
| Molar Mass | 6397.22 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Bende NS, et al. A distinct sodium channel voltage-sensor locus determines insect selectivity of the spider toxin Dc1a. Nat Commun. 2014 Jul 11;5:4350. |