| Bioactivity | retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice[1][2]. |
| Name | retro-inverso TAT-Beclin 1 (D-amino acid) |
| Sequence | d-(Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Tyr-Gly-Gly-Thr-Gly-Phe-Glu-Gly-Asp-His-Trp-Ile-Glu-Phe-Thr-Ala-Asn-Phe-Val-Asn-Thr) |
| Shortening | d-(RRRQRRKKRGYGGTGFEGDHWIEFTANFVNT) |
| Formula | C164H251N57O45 |
| Molar Mass | 3741.10 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Yanfei He, et al. Development of an autophagy activator from Class III PI3K complexes, Tat-BECN1 peptide: Mechanisms and applications. Front Cell Dev Biol. 2022 Sep 12:10:851166. [2]. Sanae Shoji-Kawata, et al. Identification of a candidate therapeutic autophagy-inducing peptide. Nature. 2013 Feb 14;494(7436):201-6. |
retro-inverso TAT-Beclin 1 (D-amino acid)
CAS: F: C164H251N57O45 W: 3741.10
retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compare
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.