PeptideDB

retro-inverso TAT-Beclin 1 (D-amino acid)

CAS: F: C164H251N57O45 W: 3741.10

retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compare
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice[1][2].
Name retro-inverso TAT-Beclin 1 (D-amino acid)
Sequence d-(Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Tyr-Gly-Gly-Thr-Gly-Phe-Glu-Gly-Asp-His-Trp-Ile-Glu-Phe-Thr-Ala-Asn-Phe-Val-Asn-Thr)
Shortening d-(RRRQRRKKRGYGGTGFEGDHWIEFTANFVNT)
Formula C164H251N57O45
Molar Mass 3741.10
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Yanfei He, et al. Development of an autophagy activator from Class III PI3K complexes, Tat-BECN1 peptide: Mechanisms and applications. Front Cell Dev Biol. 2022 Sep 12:10:851166. [2]. Sanae Shoji-Kawata, et al. Identification of a candidate therapeutic autophagy-inducing peptide. Nature. 2013 Feb 14;494(7436):201-6.