| Bioactivity | m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model[1]. |
| Target | IC50: 3.3 nM (hNaV1.7), 6.8 nM (hNaV1.6), 7.2 nM (hNaV1.3), 8.4 nM (hNaV1.1), 11.9 nM (hNaV1.2), 369 nM (hNaV1.4), > 1000 nM (hNaV1.5), > 1000 nM (hNaV1.8) |
| Name | m3-Huwentoxin IV |
| Sequence | Gly-Cys-Leu-Gly-Ile-Phe-Lys-Ala-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Lys-Leu-Val-Cys-Ser-Arg-Lys-Thr-Arg-Trp-Cys-Lys-Trp-Gln-Ile-NH2 (Disulfide bridge: Cys2-Cys17,Cys9-Cys24,Cys16-Cys31) |
| Shortening | GCLGIFKACNPSNDQCCKSSKLVCSRKTRWCKWQI-NH2 (Disulfide bridge: Cys2-Cys17,Cys9-Cys24,Cys16-Cys31) |
| Formula | C170H271N53O46S6 |
| Molar Mass | 3985.69 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Rahnama S, et al. The structure, dynamics and selectivity profile of a NaV1.7 potency-optimised huwentoxin-IV variant. PLoS One. 2017 Mar 16;12(3):e0173551. |
m3-Huwentoxin IV
CAS: F: C170H271N53O46S6 W: 3985.69
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.