PeptideDB

Tap1a

CAS: F: C174H258N52O55S7 W: 4182.68

Tap1a (Theraphotoxin-Tap1a) is a spider venom peptide that inhibits sodium channels with IC50s of 80 nM and 301 nM again
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Tap1a (Theraphotoxin-Tap1a) is a spider venom peptide that inhibits sodium channels with IC50s of 80 nM and 301 nM against Nav1.7 and Nav1.1, respectively. Tap1a shows analgesic effects[1].
Target IC50: 80 nM (Nav1.7), 301 nM (Nav1.1)
Name Tap1a
Sequence Asp-Asp-Cys-Leu-Gly-Met-Phe-Ser-Ser-Cys-Asp-Pro-Asn-Asn-Asp-Lys-Cys-Cys-Pro-Asn-Arg-Lys-Cys-Ser-Arg-Lys-Asp-Gln-Trp-Cys-Lys-Tyr-Gln-Leu-Trp (Disulfide bridge:Cys3-Cys18, Cys10-Cys23, Cys17-Cys30)
Shortening DDCLGMFSSCDPNNDKCCPNRKCSRKDQWCKYQLW (Disulfide bridge:Cys3-Cys18, Cys10-Cys23, Cys17-Cys30)
Formula C174H258N52O55S7
Molar Mass 4182.68
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Hu H, et al. Engineering of a Spider Peptide via Conserved Structure-Function Traits Optimizes Sodium Channel Inhibition In Vitro and Anti-Nociception In Vivo. Front Mol Biosci. 2021 Sep 21;8:742457.