| Bioactivity | Tap1a (Theraphotoxin-Tap1a) is a spider venom peptide that inhibits sodium channels with IC50s of 80 nM and 301 nM against Nav1.7 and Nav1.1, respectively. Tap1a shows analgesic effects[1]. |
| Target | IC50: 80 nM (Nav1.7), 301 nM (Nav1.1) |
| Name | Tap1a |
| Sequence | Asp-Asp-Cys-Leu-Gly-Met-Phe-Ser-Ser-Cys-Asp-Pro-Asn-Asn-Asp-Lys-Cys-Cys-Pro-Asn-Arg-Lys-Cys-Ser-Arg-Lys-Asp-Gln-Trp-Cys-Lys-Tyr-Gln-Leu-Trp (Disulfide bridge:Cys3-Cys18, Cys10-Cys23, Cys17-Cys30) |
| Shortening | DDCLGMFSSCDPNNDKCCPNRKCSRKDQWCKYQLW (Disulfide bridge:Cys3-Cys18, Cys10-Cys23, Cys17-Cys30) |
| Formula | C174H258N52O55S7 |
| Molar Mass | 4182.68 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Hu H, et al. Engineering of a Spider Peptide via Conserved Structure-Function Traits Optimizes Sodium Channel Inhibition In Vitro and Anti-Nociception In Vivo. Front Mol Biosci. 2021 Sep 21;8:742457. |