| Bioactivity | human GIP(3-30), amide is a high affinity antagonist of the human GIP receptor in vitro[1]. |
| Name | human GIP(3-30), amide |
| CAS | 1884226-05-4 |
| Sequence | Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 |
| Shortening | EGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2 |
| Formula | C150H226N38O44S |
| Molar Mass | 3297.69 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Sparre-Ulrich AH, et al. GIP(3-30)NH2 is a potent competitive antagonist of the GIP receptor and effectively inhibits GIP-mediated insulin, glucagon, and somatostatin release. Biochem Pharmacol. 2017;131:78-88. |