PeptideDB

human GIP(3-30), amide

CAS: 1884226-05-4 F: C150H226N38O44S W: 3297.69

human GIP(3-30), amide is a high affinity antagonist of the human GIP receptor in vitro.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity human GIP(3-30), amide is a high affinity antagonist of the human GIP receptor in vitro[1].
Name human GIP(3-30), amide
CAS 1884226-05-4
Sequence Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2
Shortening EGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2
Formula C150H226N38O44S
Molar Mass 3297.69
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Sparre-Ulrich AH, et al. GIP(3-30)NH2 is a potent competitive antagonist of the GIP receptor and effectively inhibits GIP-mediated insulin, glucagon, and somatostatin release. Biochem Pharmacol. 2017;131:78-88.