| Bioactivity | human GIP(3-30), amide TFA is a high affinity antagonist of the human GIP receptor in vitro[1]. | ||||||
| Name | human GIP(3-30), amide TFA | ||||||
| Sequence | Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 | ||||||
| Shortening | EGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2 | ||||||
| Formula | C150H226N38O44S.xC2HF3O2 | ||||||
| Molar Mass | 3297.69 (free base) | ||||||
| Appearance | 固体 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
||||||
| Reference | [1]. Sparre-Ulrich AH, et al. GIP(3-30)NH2 is a potent competitive antagonist of the GIP receptor and effectively inhibits GIP-mediated insulin, glucagon, and somatostatin release. Biochem Pharmacol. 2017;131:78-88. |
human GIP(3-30), amide TFA
CAS: F: C150H226N38O44S.xC2HF3O2 W: 3297.69 (free base)
human GIP(3-30), amide TFA is a high affinity antagonist of the human GIP receptor in vitro.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.