PeptideDB

human GIP(3-30), amide TFA

CAS: F: C150H226N38O44S.xC2HF3O2 W: 3297.69 (free base)

human GIP(3-30), amide TFA is a high affinity antagonist of the human GIP receptor in vitro.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity human GIP(3-30), amide TFA is a high affinity antagonist of the human GIP receptor in vitro[1].
Name human GIP(3-30), amide TFA
Sequence Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2
Shortening EGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2
Formula C150H226N38O44S.xC2HF3O2
Molar Mass 3297.69 (free base)
Appearance 固体
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Reference [1]. Sparre-Ulrich AH, et al. GIP(3-30)NH2 is a potent competitive antagonist of the GIP receptor and effectively inhibits GIP-mediated insulin, glucagon, and somatostatin release. Biochem Pharmacol. 2017;131:78-88.