| Bioactivity | Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research[1][2][3]. |
| Invitro | Vosoritide (0.1 μM; 1 h) decreases NPR2 phosphorylation in chondrocytes[2].Vosoritide (0.1 μM; 6 d) improves chondrocyte differentiation and increases the proliferative growth plate area of cultured Fgfr3Y367C/+ femurs[2].Vosoritide (10 μM; overnight) reduces ERK1/2 activation in ACH growth-plate chondrocytes[3]. Western Blot Analysis[2] Cell Line: |
| Name | Vosoritide |
| CAS | 1480724-61-5 |
| Sequence | Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys23-Cys39) |
| Shortening | PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys23-Cys39) |
| Formula | C176H290N56O51S3 |
| Molar Mass | 4102.73 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Vosoritide
CAS: 1480724-61-5 F: C176H290N56O51S3 W: 4102.73
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic pe
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.