PeptideDB

Cagrilintide

CAS: 1415456-99-3 F: C194H312N54O59S2 W: 4409.01

Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AM
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity[1][2][3].
Name Cagrilintide
CAS 1415456-99-3
Sequence {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-NH2 (Disulfide bridge:Cys3-Cys8)
Shortening {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
Formula C194H312N54O59S2
Molar Mass 4409.01
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.