| Bioactivity | Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity[1][2][3]. |
| Name | Cagrilintide |
| CAS | 1415456-99-3 |
| Sequence | {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-NH2 (Disulfide bridge:Cys3-Cys8) |
| Shortening | {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8) |
| Formula | C194H312N54O59S2 |
| Molar Mass | 4409.01 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Cagrilintide
CAS: 1415456-99-3 F: C194H312N54O59S2 W: 4409.01
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AM
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.