PeptideDB

Urotoxin

CAS: F: C161H260N52O50S9 W: 4012.69

Urotoxin is an inhibitor of the potassium channel. Urotoxin has a selective affinity for hKv1.2 channel.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Urotoxin is an inhibitor of the potassium channel. Urotoxin has a selective affinity for hKv1.2 channel[1].
Name Urotoxin
Sequence Gly-Asp-Ile-Lys-Cys-Ser-Gly-Thr-Arg-Gln-Cys-Trp-Gly-Pro-Cys-Lys-Lys-Gln-Thr-Thr-Cys-Thr-Asn-Ser-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Gly-Cys-Val-NH2 (Disulfide bridge: Cys5-Cys26, Cys11-Cys31, Cys15-Cys33, Cys21-Cys36)
Shortening GDIKCSGTRQCWGPCKKQTTCTNSKCMNGKCKCYGCV-NH2 (Disulfide bridge: Cys5-Cys26, Cys11-Cys31, Cys15-Cys33, Cys21-Cys36)
Formula C161H260N52O50S9
Molar Mass 4012.69
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Karen Luna-Ramírez, et al. Structure, molecular modeling, and function of the novel potassium channel blocker urotoxin isolated from the venom of the Australian scorpion Urodacus yaschenkoi. Mol Pharmacol. 2014, 86, 1.