| Bioactivity | Urotoxin is an inhibitor of the potassium channel. Urotoxin has a selective affinity for hKv1.2 channel[1]. |
| Name | Urotoxin |
| Sequence | Gly-Asp-Ile-Lys-Cys-Ser-Gly-Thr-Arg-Gln-Cys-Trp-Gly-Pro-Cys-Lys-Lys-Gln-Thr-Thr-Cys-Thr-Asn-Ser-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Gly-Cys-Val-NH2 (Disulfide bridge: Cys5-Cys26, Cys11-Cys31, Cys15-Cys33, Cys21-Cys36) |
| Shortening | GDIKCSGTRQCWGPCKKQTTCTNSKCMNGKCKCYGCV-NH2 (Disulfide bridge: Cys5-Cys26, Cys11-Cys31, Cys15-Cys33, Cys21-Cys36) |
| Formula | C161H260N52O50S9 |
| Molar Mass | 4012.69 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Karen Luna-Ramírez, et al. Structure, molecular modeling, and function of the novel potassium channel blocker urotoxin isolated from the venom of the Australian scorpion Urodacus yaschenkoi. Mol Pharmacol. 2014, 86, 1. |