| Bioactivity | Nv-CATH is an antibacterial peptide of frog origin. Nv-CATH has broad-spectrum antibacterial activity against gram-positive and gram-negative bacteria. Nv-CATH significantly protects mice from fatal infections caused by Staphylococcus aureus. Nv-CATH protects mice from bacterial infection through antimicrobial immunoregulatory duality[1]. |
| Name | Nv-CATH |
| Sequence | Asn-Cys-Asn-Phe-Leu-Cys-Lys-Val-Lys-Gln-Arg-Leu-Arg-Ser-Val-Ser-Ser-Thr-Ser-His-Ile-Gly-Met-Ala-Ile-Pro-Arg-Pro-Arg-Gly |
| Shortening | NCNFLCKVKQRLRSVSSTSHIGMAIPRPRG |
| Formula | C142H243N49O39S3 |
| Molar Mass | 3356.95 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Shi J, et al. A Frog-Derived Cathelicidin Peptide with Dual Antimicrobial and Immunomodulatory Activities Effectively Ameliorates Staphylococcus aureus-Induced Peritonitis in Mice. ACS Infect Dis. 2022 Dec 9;8(12):2464-2479. |