| Bioactivity | Teriparatide (Human parathyroid hormone-(1-34)) is a PHT agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research[1]. | ||||||
| Name | Teriparatide | ||||||
| CAS | 52232-67-4 | ||||||
| Sequence | Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe | ||||||
| Shortening | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF | ||||||
| Formula | C181H291N55O51S2 | ||||||
| Molar Mass | 4117.72 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
Teriparatide
CAS: 52232-67-4 F: C181H291N55O51S2 W: 4117.72
Teriparatide (Human parathyroid hormone-(1-34)) is a PHT agonist. Teriparatide (Human parathyroid hormone-(1-34))can be
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.