PeptideDB

Tau Peptide (255-314) (Repeat 2 Domain) (human)

CAS: 2022995-68-0 F: C277H467N83O86S W: 6368.24

Tau Peptide (255-314) (Repeat 2 Domain) (human), is a polypeptide that can be found by peptide screening. Peptide screen
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Tau Peptide (255-314) (Repeat 2 Domain) (human), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of drug research and development[1].
Name Tau Peptide (255-314) (Repeat 2 Domain) (human)
CAS 2022995-68-0
Sequence Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-Val-Gln-Ile-Ile-Asn-Lys-Lys-Leu-Asp-Leu-Ser-Asn-Val-Gln-Ser-Lys-Cys-Gly-Ser-Lys-Asp-Asn-Ile-Lys-His-Val-Pro-Gly-Gly-Gly-Ser-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp
Shortening NVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVD
Formula C277H467N83O86S
Molar Mass 6368.24
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54.