| Bioactivity | TLN-58 is an antimicrobial peptide. TLN-58 has antibacterial activity against S. aureus, S. epidermidis, and group A Streptococcus. TLN-58 also induces inflammatory cytokine mRNAs upregulation in normal human keratinocytes and NCL-SG3 cells[1]. |
| Name | TLN-58 |
| Sequence | Thr-Leu-Asn-Gln-Ala-Arg-Gly-Ser-Phe-Asp-Ile-Ser-Cys-Asp-Lys-Asp-Asn-Lys-Arg-Phe-Ala-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Shortening | TLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Formula | C305H498N92O86S |
| Molar Mass | 6861.85 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Murakami M, et al. TLN-58, an Additional hCAP18 Processing Form, Found in the Lesion Vesicle of Palmoplantar Pustulosis in the Skin. J Invest Dermatol. 2017 Feb;137(2):322-331. |