| Bioactivity | Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor[1]. |
| Name | Dermaseptin-B4 |
| CAS | 210890-56-5 |
| Sequence | Ala-Leu-Trp-Lys-Thr-Ile-Ile-Lys-Gly-Ala-Gly-Lys-Met-Ile-Gly-Ser-Leu-Ala-Lys-Asn-Leu-Leu-Gly-Ser-Gln-Ala-Gln-Pro-Glu-Ser-NH2 |
| Shortening | ALWKDILKNVGKAAGKAVLNTVTDMVNQ-NH2 |
| Formula | C133H226N38O38S |
| Molar Mass | 2997.51 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Charpentier S, et al. Structure, synthesis, and molecular cloning of dermaseptins B, a family of skin peptide antibiotics. J Biol Chem. 1998 Jun 12;273(24):14690-7. |
Dermaseptin-B4
CAS: 210890-56-5 F: C133H226N38O38S W: 2997.51
Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bico
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.