| Bioactivity | Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers[1]. |
| Name | Spinoxin |
| CAS | 752984-66-0 |
| Sequence | Ile-Arg-Cys-Ser-Gly-Ser-Arg-Asp-Cys-Tyr-Ser-Pro-Cys-Met-Lys-Gln-Thr-Gly-Cys-Pro-Asn-Ala-Lys-Cys-Ile-Asn-Lys-Ser-Cys-Lys-Cys-Tyr-Gly-Cys-NH2 (Disulfide bridge: Cys3-Cys24, Cys9-Cys29, Cys13-Cys31, Cys19-Cys34) |
| Shortening | IRCSGSRDCYSPCMKQTGCPNAKCINKSCKCYGC-NH2 (Disulfide bridge: Cys3-Cys24, Cys9-Cys29, Cys13-Cys31, Cys19-Cys34) |
| Formula | C147H236N48O46S9 |
| Molar Mass | 3700.33 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Steve Peigneur, et al. Active Sites of Spinoxin, a Potassium Channel Scorpion Toxin, Elucidated by Systematic Alanine Scanning. Biochemistry. 2016 May 31;55(21):2927-35. |
Spinoxin
CAS: 752984-66-0 F: C147H236N48O46S9 W: 3700.33
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by f
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.