| Bioactivity | Scrambled β-amyloid (1-40) is a biological active peptide. (A? (1-40) together with A? (1-42) are two major C-terminal variants of the A? protein constituting the majority of A?s. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40 HY-P0265) |
| Name | Scrambled β-amyloid (1-40) |
| CAS | 1678415-68-3 |
| Sequence | Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala |
| Shortening | AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA |
| Formula | C194H295N53O58S |
| Molar Mass | 4329.80 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Scrambled β-amyloid (1-40)
CAS: 1678415-68-3 F: C194H295N53O58S W: 4329.80
Scrambled β-amyloid (1-40) is a biological active peptide. (A? (1-40) together with A? (1-42) are two major C-terminal
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.