Scorpion toxin Tf2_product_DataBase

Bioactivity	Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials[1].
Target	Nav1.3
Name	Scorpion toxin Tf2
Sequence	Lys-Glu-Gly-Tyr-Ala-Met-Asp-His-Glu-Gly-Cys-Lys-Phe-Ser-Cys-Phe-Ile-Arg-Pro-Ser-Gly-Phe-Cys-Asp-Gly-Tyr-Cys-Lys-Thr-His-Leu-Lys-Ala-Ser-Ser-Gly-Tyr-Cys-Ala-Trp-Pro-Ala-Cys-Tyr-Cys-Tyr-Gly-Val-Pro-Ser-Asn-Ile-Lys-Val-Trp-Asp-Tyr-Ala-Thr-Asn-Lys-Cys-NH2 (Disulfide bridge: Cys11-Cys62, Cys15-Cys38, Cys23-Cys43, Cys27-Cys45)
Shortening	KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC-NH2 (Disulfide bridge: Cys11-Cys62, Cys15-Cys38, Cys23-Cys43, Cys27-Cys45)
Formula	C309H438N80O87S9
Molar Mass	6953.86
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Camargos TS, et al. The Scorpion Toxin Tf2 from Tityus fasciolatus Promotes Nav1.3 Opening. PLoS One. 2015 Jun 17;10(6):e0128578.

PeptideDB