| Bioactivity | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2[1]. | ||||||
| Name | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | ||||||
| Shortening | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | ||||||
| Formula | C164H238N40O55 | ||||||
| Molar Mass | 3649.88 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Robson B, et, al. COVID-19 Coronavirus spike protein analysis for synthetic vaccines, a peptidomimetic antagonist, and therapeutic drugs, and analysis of a proposed achilles' heel conserved region to minimize probability of escape mutations and drug resistance. Comput Biol Med. 2020 Jun;121:103749. |
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
CAS: F: C164H238N40O55 W: 3649.88
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the fun
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.