| Bioactivity | RVG-Cys(RVG29-Cys) is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling[1]. |
| Name | RVG-Cys |
| CAS | 1186105-01-0 |
| Sequence | Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Cys |
| Shortening | YTIWMPENPRPGTPCDIFTNSRGKRASNGC |
| Formula | C144H222N44O44S3 |
| Molar Mass | 3369.77 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Yang Liu, et al. Brain-targeting gene delivery and cellular internalization mechanisms for modified rabies virus glycoprotein RVG29 nanoparticles. Biomaterials. 2009 Sep;30(25):4195-202. |
RVG-Cys
CAS: 1186105-01-0 F: C144H222N44O44S3 W: 3369.77
RVG-Cys(RVG29-Cys) is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent c
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.