| Bioactivity | Pterinotoxin-2 is a sodium channel inhibitor peptide toxin[1]. |
| Name | Pterinotoxin-2 |
| Sequence | Tyr-Cys-Gln-Glu-Phe-Leu-Trp-Thr-Cys-Asp-Glu-Glu-Arg-Lys-Cys-Cys-Gly-Asp-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Arg-Leu-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25) |
| Shortening | YCQEFLWTCDEERKCCGDMVCRLWCKKRL-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25) |
| Formula | C156H237N45O42S7 |
| Molar Mass | 3639.28 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Marit Poffers, et al. Sodium Channel Nav1.3 Is Expressed by Polymorphonuclear Neutrophils during Mouse Heart and Kidney Ischemia InVivo and Regulates Adhesion, Transmigration, and Chemotaxis of Human and Mouse Neutrophils In Vitro. Anesthesiology. 2018 Jun;128(6):1151-1166. |