| Bioactivity | PP113 is an antimicrobial peptide is active against Gram-negative and Gram-positive bacteria, E.coli (MIC: 73.3 uM), B. subtilis (MIC: 23.3 uM), S. aureus (MIC: 13 uM), S. lutea (MIC: 16.7 uM), and B. pumilu (MIC: 23.3 uM)[1]. |
| Name | PP113 |
| Sequence | Gly-Lys-Trp-Gly-Trp-Ile-Tyr-Ile-Thr-Ile-Leu-Phe-Ala-Asp-Val-Gly-Gly-Phe-Lys-Ser-Ser-Arg-His-Pro-Glu-Glu-Arg-Arg-Val-Gln-Glu-Arg-Arg-Phe-Lys-Arg-Ile-Thr-Arg-Gly-Pro-Asp |
| Shortening | GKWGWIYITILFADVGGFKSSRHPEERRVQERRFKRITRGPD |
| Formula | C229H355N71O59 |
| Molar Mass | 5046.71 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Shen X, et al. Novel antimicrobial peptides identified from an endoparasitic wasp cDNA library. J Pept Sci. 2010 Jan;16(1):58-64. |