| Bioactivity | Preptin, an osteogenic peptide product of the pancreatic beta-cell, corresponds to Asp69-Leu102 of pro-IGF-II[1]. |
| Invitro | Preptin dose-dependently stimulates the proliferation (cell numberand DNA synthesis) of primary fetal rat osteoblasts and osteoblast-likecell lines at periphysiological concentrations (10-11M)[1]. |
| Name | Preptin (rat) |
| CAS | 315197-73-0 |
| Sequence | Asp-Val-Ser-Thr-Ser-Gln-Ala-Val-Leu-Pro-Asp-Asp-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Lys-Phe-Asp-Thr-Trp-Arg-Gln-Ser-Ala-Gly-Arg-Leu |
| Shortening | DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL |
| Formula | C181H268N48O51 |
| Molar Mass | 3932.36 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. J Cornish, et al. Preptin, another peptide product of the pancreatic beta-cell, is osteogenic in vitro and in vivo. Am J Physiol Endocrinol Metab. 2007 Jan;292(1):E117-22. |