PeptideDB

Preptin (rat)

CAS: 315197-73-0 F: C181H268N48O51 W: 3932.36

Preptin, an osteogenic peptide product of the pancreatic beta-cell, corresponds to Asp69-Leu102 of pro-IGF-II.
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Preptin, an osteogenic peptide product of the pancreatic beta-cell, corresponds to Asp69-Leu102 of pro-IGF-II[1].
Invitro Preptin dose-dependently stimulates the proliferation (cell numberand DNA synthesis) of primary fetal rat osteoblasts and osteoblast-likecell lines at periphysiological concentrations (10-11M)[1].
Name Preptin (rat)
CAS 315197-73-0
Sequence Asp-Val-Ser-Thr-Ser-Gln-Ala-Val-Leu-Pro-Asp-Asp-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Lys-Phe-Asp-Thr-Trp-Arg-Gln-Ser-Ala-Gly-Arg-Leu
Shortening DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL
Formula C181H268N48O51
Molar Mass 3932.36
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. J Cornish, et al. Preptin, another peptide product of the pancreatic beta-cell, is osteogenic in vitro and in vivo. Am J Physiol Endocrinol Metab. 2007 Jan;292(1):E117-22.