| Bioactivity | Phrixotoxin-1 (TFA), from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of Kv4 potassium channel[1][2]. | ||||||
| Name | Phrixotoxin-1 TFA | ||||||
| Sequence | Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Ala-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Ile-Ile-NH2 (Disulfide bridge: Cys2-Cys16; Cys9-Cys21; Cys15-Cys25) | ||||||
| Shortening | YCQKWMWTCDSARKCCEGLVCRLWCKKII-NH2 (Disulfide bridge: Cys2-Cys16; Cys9-Cys21; Cys15-Cys25) | ||||||
| Formula | C156H240N44O37S7.xC2HF3O2 | ||||||
| Molar Mass | 3548.30 (free base) | ||||||
| Appearance | 固体 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
||||||
| Reference | [1]. Benjamin Chagot, et al. Solution structure of Phrixotoxin 1, a specific peptide inhibitor of Kv4 potassium channels from the venom of the theraphosid spider Phrixotrichus auratus. Protein Sci. 2004, 13, 5. [2]. Grit Schaarschmidt, et al. Characterization of Voltage-Gated Potassium Channels in Human Neural Progenitor Cells. PLoS One. 2009, 4, 7. |
Phrixotoxin-1 TFA
CAS: F: C156H240N44O37S7.xC2HF3O2 W: 3548.30 (free base)
Phrixotoxin-1 (TFA), from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.