PeptideDB

Phrixotoxin-1 TFA

CAS: F: C156H240N44O37S7.xC2HF3O2 W: 3548.30 (free base)

Phrixotoxin-1 (TFA), from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Phrixotoxin-1 (TFA), from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of Kv4 potassium channel[1][2].
Name Phrixotoxin-1 TFA
Sequence Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Ala-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Ile-Ile-NH2 (Disulfide bridge: Cys2-Cys16; Cys9-Cys21; Cys15-Cys25)
Shortening YCQKWMWTCDSARKCCEGLVCRLWCKKII-NH2 (Disulfide bridge: Cys2-Cys16; Cys9-Cys21; Cys15-Cys25)
Formula C156H240N44O37S7.xC2HF3O2
Molar Mass 3548.30 (free base)
Appearance 固体
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Reference [1]. Benjamin Chagot, et al. Solution structure of Phrixotoxin 1, a specific peptide inhibitor of Kv4 potassium channels from the venom of the theraphosid spider Phrixotrichus auratus. Protein Sci. 2004, 13, 5.   [2]. Grit Schaarschmidt, et al. Characterization of Voltage-Gated Potassium Channels in Human Neural Progenitor Cells. PLoS One. 2009, 4, 7.