| Bioactivity | Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel[1][2]. |
| Target | NaV1.7 |
| Name | Phlotoxin-1 |
| Sequence | Ala-Cys-Leu-Gly-Gln-Trp-Asp-Ser-Cys-Asp-Pro-Lys-Ala-Ser-Lys-Cys-Cys-Pro-Asn-Tyr-Ala-Cys-Glu-Trp-Lys-Tyr-Pro-Trp-Cys-Arg-Tyr-Lys-Leu-Phe (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29) |
| Shortening | ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29) |
| Formula | C183H254N46O48S6 |
| Molar Mass | 4058.64 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Gonçalves TC, et al. Evaluation of the Spider (Phlogiellus genus) Phlotoxin 1 and Synthetic Variants as Antinociceptive Drug Candidates. Toxins (Basel). 2019 Aug 22;11(9):484. [2]. Nicolas S, et al. Chemical Synthesis, Proper Folding, Nav Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. |