PeptideDB

Phlotoxin-1

CAS: F: C183H254N46O48S6 W: 4058.64

Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus gen
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel[1][2].
Target NaV1.7
Name Phlotoxin-1
Sequence Ala-Cys-Leu-Gly-Gln-Trp-Asp-Ser-Cys-Asp-Pro-Lys-Ala-Ser-Lys-Cys-Cys-Pro-Asn-Tyr-Ala-Cys-Glu-Trp-Lys-Tyr-Pro-Trp-Cys-Arg-Tyr-Lys-Leu-Phe (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
Shortening ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
Formula C183H254N46O48S6
Molar Mass 4058.64
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Gonçalves TC, et al. Evaluation of the Spider (Phlogiellus genus) Phlotoxin 1 and Synthetic Variants as Antinociceptive Drug Candidates. Toxins (Basel). 2019 Aug 22;11(9):484. [2]. Nicolas S, et al. Chemical Synthesis, Proper Folding, Nav Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367.